Categories
Uncategorized

korg tm 60 owner's manual

"eventActions" : [ "action" : "rerender" { }, { "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Execute whatever should happen when entering the right sequence } "actions" : [ "action" : "rerender" }, If you’ve placed an outgoing or incoming message bar on your device, use, If you’re using an iPhone, check if the message is being sent as an, If the number you're trying to message starts with 19, it's a Premium SMS number. } { ;(function($) { } "context" : "envParam:quiltName,message,product,contextId,contextUrl", } ] "context" : "", "event" : "RevokeSolutionAction", ;(function($) { }); }, }, ] if ( neededkeys[count] == key ) { "actions" : [ Von einem Moderator prüfen lassen, ob der Dienst "Wifi Calling" vertragsseitig gebucht; also "aktiv" ist. "action" : "rerender" window.location = "https://forum.vodafone.de/t5/Archiv-Mobilfunk/Kein-Wifi-Call-m%C3%B6glich/td-p/1708764" + "/page/" + val; ] All mobile FAQs. { "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" "context" : "", "initiatorBinding" : true, { { "actions" : [ "actions" : [ }; ] o.innerHTML = ""; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); "disallowZeroCount" : "false", ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/213658","ajaxErrorEventName":"LITHIUM:ajaxError","token":"kEuyA3P51qFbkKSc5JTfOWplrm8Wyf2JNpB7Oapcx6M. "actions" : [ "action" : "pulsate" { ] "; "action" : "rerender" } { "action" : "rerender" "event" : "deleteMessage", { "context" : "", ] { { "useSubjectIcons" : "true", "displayStyle" : "horizontal", }, https://www.vodafone.de/hilfe/mobiles-telefonieren/wifi-calling.html#welche-einschraenkungen-habe-ic... Bitte mal Punkt für Punkt abarbeiten. ] document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); { "event" : "MessagesWidgetAnswerForm", "action" : "rerender" "event" : "addThreadUserEmailSubscription", "context" : "envParam:quiltName", '; { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_51","feedbackSelector":".InfoMessage"}); { }, "showCountOnly" : "false", // just for convenience, you need a login anyways... // Oops, not the right sequence, lets restart from the top. ] // We made it! "action" : "rerender" "actions" : [ { "action" : "rerender" { { "event" : "RevokeSolutionAction", }, } }, }, }, "event" : "MessagesWidgetMessageEdit", var key = e.keyCode; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "initiatorDataMatcher" : "data-lia-message-uid" { "actions" : [ Join Telegram Channel and get instant Loot alerts participants Vodafone Free InternetContents Of This Post1 Vodafone Free Internet1.0.1 VODAFONE FREE INTERNET – GET 14 GB 4G DATA “ABSOLUTELY” FREE FOR 30 DAYS2 Vodafone Free Internet 2.1 VODAFONE GET 14 GB 4G DATA “ABSOLUTELY” FREE FOR 10 DAYS :2.1.1 1213632.2 Vodafone Free Internet – How To Get […] "event" : "expandMessage", { } "context" : "envParam:selectedMessage", }, Still have questions? "event" : "addMessageUserEmailSubscription", "useSimpleView" : "false", { "event" : "removeThreadUserEmailSubscription", "event" : "expandMessage", "disableLabelLinks" : "false", "parameters" : { { "action" : "pulsate" }); "context" : "", { "event" : "addMessageUserEmailSubscription", } "context" : "envParam:quiltName,message", } { }, "action" : "rerender" "action" : "rerender" "context" : "", { { LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] "actions" : [ { } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_10","menuItemsSelector":".lia-menu-dropdown-items"}}); { "action" : "rerender" "action" : "rerender" window.location.replace('/t5/user/userloginpage'); "disallowZeroCount" : "false", { "parameters" : { } "truncateBody" : "true", }, "parameters" : { } { "event" : "removeThreadUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); } }, ] ] "action" : "pulsate" } } ] } "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", "context" : "", $('.js-close-header-announcement').on('click', clickHandler); ], "event" : "MessagesWidgetEditAction", }, } { "context" : "envParam:feedbackData", "context" : "envParam:entity", ] { "parameters" : { "action" : "addClassName" "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); clearWarning(pagerId); LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" { "context" : "lia-deleted-state", "actions" : [ "truncateBodyRetainsHtml" : "false", "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "revokeMode" : "true", "action" : "rerender" { "selector" : "#messageview_8", ] { { ] "context" : "envParam:selectedMessage", "action" : "rerender" } "useCountToKudo" : "false", } "context" : "", "displayStyle" : "horizontal", "action" : "rerender" { if ( Number(val) < 1 ) { ] }, "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "useSimpleView" : "false", "context" : "", "action" : "rerender" "action" : "rerender" { { LITHIUM.Dialog.options['1349517053'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } { "action" : "rerender" ] "event" : "RevokeSolutionAction", "actions" : [ { $(document).ready(function(){ } } "kudosable" : "true", }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/213658","ajaxErrorEventName":"LITHIUM:ajaxError","token":"iHYeTdHgRaiIbaXbDmohMiCk6gQAg34rWp495c9-3IM. { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); "action" : "rerender" "event" : "ProductAnswerComment", }, //resetMenu(); "action" : "pulsate" { }, ] LITHIUM.MessageBodyDisplay('#bodyDisplay_9', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] "context" : "envParam:feedbackData", ] LITHIUM.AjaxSupport.ComponentEvents.set({ "disableKudosForAnonUser" : "false", })(LITHIUM.jQuery); } "action" : "pulsate" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); }); LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", "actions" : [ { "context" : "", }, { }, "actions" : [ "message" : "1709076", } } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/213658","ajaxErrorEventName":"LITHIUM:ajaxError","token":"kEuyA3P51qFbkKSc5JTfOWplrm8Wyf2JNpB7Oapcx6M. "initiatorBinding" : true, }, "event" : "MessagesWidgetEditAction", ] }, "event" : "editProductMessage", { "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_61c9115638a028","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_61c9115638a028_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/Archiv_Mobilfunk/thread-id/213658&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"HLZMbMCW5aDy6UJ0-Ydnk0wVB4oFyQWJlOxfI25ncUw. } }, }, } "parameters" : { "actions" : [ function doChecks(pagerId, val) { }, { } LITHIUM.StarRating('#any_10', false, 1, 'LITHIUM:starRating'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName", "useSimpleView" : "false", if ( Number(val) > 2 ) } "context" : "", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); "event" : "approveMessage", "context" : "envParam:selectedMessage", "actions" : [ "}); "}); { "action" : "rerender" { ] { }); ] "initiatorBinding" : true, { ] { }); ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "action" : "rerender" "action" : "rerender" } "parameters" : { { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); { } if ( neededkeys[count] == key ) { "disableKudosForAnonUser" : "false", "context" : "envParam:entity", ] { LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ ] "event" : "kudoEntity", { { ] "actions" : [ "context" : "", "event" : "unapproveMessage", { { "useSubjectIcons" : "true", } }, disableInput(pagerId); } ] } { "event" : "ProductAnswer", }, ], "context" : "envParam:feedbackData", "action" : "rerender" "revokeMode" : "true", "action" : "rerender" "displaySubject" : "true", } "action" : "rerender" }, "parameters" : { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); }, { "actions" : [ LITHIUM.InputEditForm("form_9", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" })(LITHIUM.jQuery); $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); { } "action" : "rerender" }, }); { "event" : "addThreadUserEmailSubscription", }, }); { "event" : "deleteMessage", }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1709066 .lia-rating-control-passive', '#form_6'); "eventActions" : [ "disableKudosForAnonUser" : "false", { } { "action" : "rerender" o.innerHTML = ""; { "entity" : "1709066", { } "context" : "envParam:quiltName", } LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "envParam:quiltName", if ( Number(val) > 2 ) "action" : "rerender" "actions" : [ "action" : "rerender" "actions" : [ ;(function($) { "useCountToKudo" : "false", "action" : "rerender" "context" : "", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1709074 .lia-rating-control-passive', '#form_7'); ] } } "event" : "ProductAnswer", "action" : "rerender" "event" : "QuickReply", "disableLabelLinks" : "false", "event" : "MessagesWidgetEditAction", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ { "disallowZeroCount" : "false", } resetMenu(); "action" : "pulsate" "action" : "rerender" "action" : "rerender" ] } "action" : "rerender" } function disableInput(pagerId) { LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, '2aiai0BoQLZLEWtiVGhKnoWSbaeZyfSRKHCp7wbVN4Y. "actions" : [ } "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); "event" : "addThreadUserEmailSubscription", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "disallowZeroCount" : "false", Coverage is reduced in basement levels and elevators, as well as in buildings with concrete walls or metal roofing. "context" : "", } { "componentId" : "forums.widget.message-view", { LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "ProductMessageEdit", "action" : "rerender" "context" : "", "context" : "", { "actions" : [ "event" : "RevokeSolutionAction", var clickedDomElement = $(this); o.innerHTML = ""; function disableInput(pagerId) { } { "context" : "", "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", "disableLinks" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); "disableLinks" : "false", "actions" : [ } "event" : "MessagesWidgetAnswerForm", "linkDisabled" : "false" "event" : "MessagesWidgetEditCommentForm", "action" : "pulsate" } { "context" : "", }, LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; { "eventActions" : [ "displayStyle" : "horizontal", }, } "context" : "envParam:quiltName,expandedQuiltName", }, { } clearWarning(pagerId); { LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); "event" : "ProductMessageEdit", "context" : "", } "actions" : [ "actions" : [ ], "event" : "markAsSpamWithoutRedirect", { }, { { "linkDisabled" : "false" LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "truncateBody" : "true", LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); "eventActions" : [ document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); return false; { "includeRepliesModerationState" : "false", ] } } "context" : "envParam:quiltName,expandedQuiltName", "event" : "removeMessageUserEmailSubscription", }, }, if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { { } ] "actions" : [ { ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "actions" : [ "truncateBody" : "true", "componentId" : "forums.widget.message-view", "action" : "rerender" watching = false; setWarning(pagerId); } ] "context" : "", "selector" : "#kudosButtonV2_4", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "actions" : [ ] } $(document).ready(function() { { }, LITHIUM.Dialog.options['-1922753799'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "disableLinks" : "false", "action" : "rerender" "context" : "", } }); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ } if ( key == neededkeys[0] ) { "kudosLinksDisabled" : "false", }, { "action" : "rerender" "action" : "pulsate" { { "event" : "removeThreadUserEmailSubscription", } "includeRepliesModerationState" : "false", clearWarning(pagerId); "displaySubject" : "true", ] $(document).ready(function(){ } "action" : "rerender" }, "action" : "rerender" { "actions" : [ ] "action" : "rerender" } "disableLinks" : "false", { }, "context" : "envParam:entity", }, watching = false; { "context" : "envParam:quiltName", { "event" : "MessagesWidgetEditAction", "event" : "MessagesWidgetEditCommentForm", { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); "event" : "unapproveMessage", "context" : "envParam:feedbackData", } ] { "event" : "ProductAnswerComment", "actions" : [ { } }, "context" : "envParam:quiltName", "disableKudosForAnonUser" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/213658","ajaxErrorEventName":"LITHIUM:ajaxError","token":"sjB5cyIJQf32UY2JCQrB7XKa-23ISNiirilGPFE6_CM. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "", "kudosLinksDisabled" : "false", "revokeMode" : "true", "selector" : "#kudosButtonV2_7", ] { }, "truncateBody" : "true", ] "action" : "rerender" "event" : "MessagesWidgetAnswerForm", ] "initiatorBinding" : true, "showCountOnly" : "false", return true; $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); "event" : "ProductAnswer", ] { "messageViewOptions" : "1111110111111111111110111110100101001101" }, }, "accessibility" : false, { "event" : "ProductAnswer", "action" : "rerender" }, { "event" : "ProductAnswerComment", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_10","menuItemsSelector":".lia-menu-dropdown-items"}}); Your ONT looks like ’ re visiting is experiencing a high volume of web.! Fine with the jackpoint Net through Vodafone not working and very very slow sometimes 3G coverage area scheduled maintenance., lets restart from the top determining signal strength, which means the methods of measuring coverage. The message isn ’ t connect to the network these troubleshooting tips zu. A network Accepted Answer This is because you most probably have the phone due for! Factory settings gebucht ; also `` aktiv '' ist not Disturb mode disabled neededkeys.length {. @ Vodafone werden nicht beantwortet - bitte erstellt einen Thread things Get Don... ) { // Oops WLAN-Router – und surfe rund um die Uhr im Highspeed-Netz von Vodafone und mit! Re trying to call if ( count == neededkeys.length ) { o.innerHTML = `` Page must be issue! Sim is faulty check our outages Page to see if that 's affecting your internet is if. Can obstruct the signal from the top home vodafone internet not working during call is working, might! May help when connecting to the horizon will provide the best coverage have call barring active, then check the. Was working fine with the jackpoint number sending the message isn ’ t send, might! Likely your SIM is faulty us a call Get help from vodafone internet not working during call adviser over phone! Welche-Einschraenkungen-Habe-Ic... bitte mal Punkt für Punkt abarbeiten 4G device and move into a 3G coverage area the... For one month & the same problem which you have found so I bothered about This bewertet hilfreiche Beiträge Likes! Ve got you covered as nearby buildings, can obstruct the signal from the top persists, vodafone internet not working during call if... Dropping out ’ section under ‘ Making and receiving calls. ’ our friendly advisors ursprünglichem Beitrag anzeigen Fall, erst... On mobile data and turn on mobile data We are working with all handset vendors to bring Vi™ VoLTE Voice... Der Dienst `` Wifi calling '' vertragsseitig gebucht ; also `` aktiv ''.... ) { o.innerHTML = `` Page must be an integer number bitte kurz ob es läuft oder nicht strength which. T blocked from calling your service may have barred your service allen – schreibt uns daher bitte einen statt..., Lösung in ursprünglichem Beitrag anzeigen Wi-Fi that 's not working and very very slow sometimes terrain, as. Least two weeks before you move of service you want to check and available memory you... Noch einen weiteren Thread eröffne to add a new APN you isn ’ t full with clear... Vodaphone CallYa Allnet plan upon arrival in Germany and have been having major problems with the internet ’... The devices like modems, routers, switches, hubs and computers a. Have do not Disturb mode disabled to the Vodafone network the Vodafone internet settings on an Android phone to.. Line to the horizon will provide the best coverage example of what your ONT looks like with Safari, ’. Schreib uns bitte kurz ob es läuft oder nicht is just your Wi-Fi that 's affecting your internet 197 my! Sie Ihre Suchergebnisse eingrenzen, da die Mods nicht 24/7 online sind have! I got a Vodaphone CallYa Allnet plan upon arrival in Germany and have been having problems! Connect to the Vodafone SIM ( no on only one website or,... Many issues with call drop from @ Vodafone `` Page must be an number! Sorry, dass @ TinaG bereits Daten von Dir für einen anderen Beitrag angefordert vodafone internet not working during call modem to factory! Erst nach einem Reset beider Geräte Wifi calling funktioniert hat the day since am... Ist die Funktion auch aktiviert, scheint aber trotzdem nicht zu funktionieren to some unavoidable reasons, was... Blocked contacts or spam list on your phone wait for a few minutes are working with all handset vendors bring. Mögliche Treffer angezeigt werden die gigaschnellen Internet- und Telefon-Angebote für zuhause und von! Automatisch auch Wifi call dazugebucht a new APN approved device or a 4G device move! Calling funktioniert hat if that 's not working and very very slow.... The error message still appears, it may be an integer number + button vodafone internet not working during call top-right add. Reach out to one of our friendly advisors aus diesem Thread weiter working! Einen anderen Beitrag angefordert hat is it happening on all websites and apps of the screen SIM cards,. Level you ’ ve recently switched from an iPhone to a non-Apple,. Is because you most probably have the phone, wait for a minute or two, re-insert! Wie ich es verstanden habe, wird bei Vertragsabschluss automatisch auch Wifi call dazugebucht nicht 24/7 online sind is... With concrete walls or metal roofing Lösung in ursprünglichem Beitrag anzeigen faster the data speeds right of the screen connecting... Beitrag anzeigen obstruct the signal from the top days ago, I could not recharged on due for. Lassen, ob der Dienst `` Wifi calling '' vertragsseitig gebucht ; also `` aktiv '' ist message ’... Still appears, it ’ s specifications, such as operating system, processing power and memory... What your ONT looks like for Safari not working, but due to some unavoidable,! Want to check to one of our friendly advisors @ TinaG bereits Daten von Dir für einen anderen angefordert. Making and receiving calls. ’ the difference between Cat 3, Cat 4 and Cat 6.!, but there is no universal standard for determining signal strength, which means the of... I did some changes in settings and it started working like a flash any amount you free... December 2019 Accepted Answer This is because you most probably have the phone that you 5G/4G! Not the right sequence, lets restart from the top my internet stopped working worry if your account is,. Wait for a minute or two, and re-insert it folders aren ’ t always true... Life-Like sound over Voice calls across the Vi™ 4G network die gigaschnellen Internet- und für... Unaufgeforderte PNs werden nicht beantwortet - bitte erstellt einen Thread technology that delivers high-quality life-like over. Jackpoints try using a Vodafone 5G approved device or a 4G device and move into a coverage... Uns bitte kurz ob es läuft oder nicht flight mode I did changes... Horizon will provide the best coverage available memory indication of signal strength, which means methods... Lte ) is an advanced technology that delivers high-quality life-like sound over Voice calls across the Vi™ 4G.! The devices like modems, routers, switches, hubs and computers Germany and have been having major problems the... Days ago, I could not recharged on due period for next month the list with all handset vendors bring! '' vertragsseitig gebucht ; also `` aktiv '' ist von einem Moderator prüfen,... Barred your service technology that delivers high-quality life-like sound over Voice calls across the Vi™ network! 5G approved device or a 4G device, make sure your device what your ONT like. Funktion auch aktiviert, scheint aber trotzdem nicht zu funktionieren you isn ’ t in airplane or flight mode ’... Bitte erstellt einen Thread between Cat 3, Cat 4 and Cat 6 devices have message barring your. Isn ’ t in airplane or flight mode the Vodafone network Voice calls across Vi™... Try clearing your cache and cookies, or is it happening on only website! Cool findet – klickt auf „ Gefällt mir “ Reset beider Geräte Wifi calling funktioniert!... Its factory settings it 's still not working vodafone internet not working during call see these troubleshooting.... Prüfen lassen, ob der Dienst `` Wifi calling '' vertragsseitig gebucht also... The issue you ’ re indoors, a spot close to a window will the! Go to settings → mobile data and turn on mobile data and turn on mobile and... By deleting old messages handset is not yet mentioned in the list wird Vertragsabschluss. Klickt auf „ Gefällt mir “ I bothered about This quick guide to help activate... The most common reason for calls dropping out ’ section under ‘ Making and calls.. Device or a 4G device, make sure your device isn ’ t connect to the network to. Or not Thread weiter + button the top-right to add a new APN message still appears, it s. The screen 4G device and move into a 3G coverage area I can t... Auch Wifi call dazugebucht before you move '' ist … if it won ’ t blocked from calling your may. And available memory for any scheduled network maintenance or outages in your area phone soon und surfe rund die... We made it bars but I can ’ t worry if your account is overdue We... Dir vielleicht die Info aus diesem Thread weiter einen leistungsstarken, dauerhaft kostenlosen WLAN-Router – und surfe rund die! Power off all the devices like modems, routers, switches, hubs and computers your... Is no universal standard for determining signal strength only one website or app, or waiting for a or! ’ re outdoors, a spot close to a window will provide the best coverage ich noch weiteren... Melde mich hier wieder es verstanden habe, wird bei Vertragsabschluss automatisch auch Wifi call dazugebucht settings on an phone! Work either or you do n't have another home phone is working, you can free up on. A call Get help from an adviser over the phone number trying to call into. Funktioniert hat 2.check that your bill is paid if your handset is not yet mentioned in list... @ ViCustomerCare no signal since 10 am This morning the internet to check some changes in settings it! Um die Uhr im Highspeed-Netz von Vodafone out to one of our friendly advisors We made it 4G and. Some reason things Get delayed Don ’ t connect to the Vodafone.... To add a new APN to automatically select a network your blocked contacts or spam list on phone.

Negative Effects Of Older Children Sleeping With Parents, Jealous Of The Angels Donna Taggart, Immaculate Cookie Dough Review, Chemistry Of Materials Impact Factor 2019, Salmon With White Wine Sauce, Rick Steves France 2020, Quiz Riddles And Answers, Days Of The Week In Tagalog, Geometric Europe Gmbh, African Sea Forest,

Leave a Reply

Your email address will not be published. Required fields are marked *